PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG729300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 295aa    MW: 32484.9 Da    PI: 8.6944
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG729300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.7e-18113166356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Pavir.9NG729300.2.p 113 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 166
                          4568999**********************************************9 PP

2HD-ZIP_I/II126.21.4e-40112201190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n++L +++++L++e
  Pavir.9NG729300.2.p 112 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYNALKRQLDAVKADNDALLSHNKKLQAE 201
                          69*************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1894169IPR009057Homeodomain-like
SuperFamilySSF466891.5E-19103170IPR009057Homeodomain-like
PROSITE profilePS5007117.346108168IPR001356Homeobox domain
SMARTSM003891.3E-17111172IPR001356Homeobox domain
CDDcd000867.40E-17113169No hitNo description
PfamPF000462.6E-15113166IPR001356Homeobox domain
PRINTSPR000311.3E-5139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5148164IPR000047Helix-turn-helix motif
PfamPF021835.2E-11168201IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MRPMASNGMA SSPSPFFPPN FLLQMQQTPP DHDPQEHHHH HEHHLPPPLH PHHNPFLPSS  60
QCPSLQDFRG MAPMLGKRPM YGAEVGGGDE ANCGGGGGNE DELSDDGSQA GEKKRRLNVE  120
QVRTLEKNFE LGNKLEPERK LQLARALGLQ PRQVAIWFQN RRARWKTKQL EKDYNALKRQ  180
LDAVKADNDA LLSHNKKLQA EALHSSAGIH VGFGARSRKV VGSGAHGRRC LFTCAPTYRL  240
PACLCGILML QRQGGVAATA SEWLLEWELE KPAAEYAASR VSVSSSFLSL FGCV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.185940.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9664900.0EU966490.1 Zea mays clone 294849 homeobox-leucine zipper protein HAT7 mRNA, complete cds.
GenBankKJ7285060.0KJ728506.1 Zea mays clone pUT6811 HB transcription factor (HB102) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465782.11e-119hypothetical protein SORBIDRAFT_01g045740
SwissprotA2XD086e-84HOX21_ORYSI; Homeobox-leucine zipper protein HOX21
TrEMBLC5WVY21e-119C5WVY2_SORBI; Putative uncharacterized protein Sb01g045740
STRINGSb01g045740.11e-119(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-55HD-ZIP family protein